Rabbit Polyclonal Anti-C22orf28 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the N terminal of human C22orf28. Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG |
Rabbit Polyclonal Anti-C22orf28 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the middle region of human C22orf28. Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC |
Goat Anti-HSPC117 (aa201-215), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QADPNKVSARAKKR., from the internal region of the protein sequence according to NP_055121.1. |
RTCB rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RTCB |
RTCB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 236-505 of human RTCB (NP_055121.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
