Antibodies

Jump to Filters
View as table Download
Rhotekin 2 (RTKN2) Rabbit Polyclonal Antibody
TA334812

USD 375.00

5 Days

Rabbit Polyclonal Anti-RTKN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTKN2 antibody is: synthetic peptide directed towards the N-terminal region of Human RTKN2. Synthetic peptide located within the following region: DIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDI
RTKN2 Rabbit Polyclonal Antibody
TA366216

USD 380.00

4 Weeks

RTKN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RTKN2
RTKN2 Rabbit Polyclonal Antibody
TA370567

USD 380.00

4 Weeks

RTKN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RTKN2