Germany
Japan
United Kingdom
China
Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the C-terminal of human Nogo-A |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI |
Rabbit Polyclonal Anti-RTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV |
Anti-RTN4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1179-1192 amino acids of Human reticulon 4 |
RTN4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RTN4. |
| Modifications | Unmodified |
Active filters
Target Symbol
- RTN4