Rabbit Polyclonal RTN4RL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal RTN4RL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RTN4RL2. |
Rabbit Polyclonal RTN4RL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal RTN4RL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RTN4RL2. |
Rabbit Polyclonal Anti-RTN4RL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RTN4RL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL2. Synthetic peptide located within the following region: DYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPH |
Recombinant Anti-NgR2 (Clone P14)
Applications | ELISA, FC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |