Germany
Japan
United Kingdom
China
RTP1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 161-189 amino acids from the C-terminal region of Human RTP1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RTP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTP1 antibody is: synthetic peptide directed towards the C-terminal region of Human RTP1. Synthetic peptide located within the following region: SEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLII |
Rabbit Polyclonal Anti-RTP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human RTP1. Synthetic peptide located within the following region: RWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHN |
Active filters
Target Symbol
- RTP1