Germany
Japan
United Kingdom
China
Antibodies
View as table Download
LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human |
| Immunogen | Synthetic Human Relaxin Receptor 2 (144-158) |
LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human |
| Immunogen | Synthetic Human Relaxin Receptor 2 (144-158) |
RXFP2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RXFP2 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI |
RXFP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). |
| Modifications | Unmodified |
RXFP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RXFP2