Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-Rab14 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab14 produced in E. coli. |
Rabbit Polyclonal Anti-RAB14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Murin |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG |
RAB14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB14 |
RAB14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse RAB14 |
RAB14 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 126-215 of human RAB14 (NP_057406.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RAB14