Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RAB7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB7L1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAB7L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB7L1 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB7L1. Synthetic peptide located within the following region: QDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTE |
Rabbit Polyclonal Anti-RAB7L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB7L1 antibody is: synthetic peptide directed towards the N-terminal region of Human RAB7L1. Synthetic peptide located within the following region: RDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGGQERFTSMTRLY |
RAB29 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAB29 |
Active filters
Target Symbol
- RAB29