Goat Polyclonal Anti-Rab38 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab38 produced in E. coli. |
Rabbit polyclonal anti-RAB38 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB38. |
Rabbit Polyclonal anti-RAB38 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB38 antibody: synthetic peptide directed towards the N terminal of human RAB38. Synthetic peptide located within the following region: MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV |
Anti-RAB38 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 100-115 amino acids of human RAB38, member RAS oncogene family |
RAB38 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAB38 |
RAB38 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 92-211 of human RAB38 (NP_071732.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
