Germany
Japan
United Kingdom
China
Rab6b rat monoclonal antibody, clone KT79, Aff - Purified
| Applications | IF, WB |
| Reactivities | Mouse |
Antibodies
View as table DownloadRab6b rat monoclonal antibody, clone KT79, Aff - Purified
| Applications | IF, WB |
| Reactivities | Mouse |
Rab6b rat monoclonal antibody, clone KT79, Aff - Purified
| Applications | IF, WB |
| Reactivities | Mouse |
Rabbit Polyclonal Anti-Rab6b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rab6b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rab6b. Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS |
RAB6B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB6B |
RAB6B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAB6B |
Active filters
Target Symbol
- RAB6B