Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against RAB8A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NQGVKITPDQQKR, from the C Terminus of the protein sequence according to NP_005361.2. |
Rabbit Polyclonal Anti-RAB8A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP |
Anti-RAB8A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 173-187 amino acids of Human Ras-related protein Rab-8A |
RAB8A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human RAB8A |
Active filters
Target Symbol
- RAB8A