Rabbit Polyclonal Anti-RABGAP1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RABGAP1L antibody is: synthetic peptide directed towards the middle region of Human RABGAP1L. Synthetic peptide located within the following region: EVVSLQRESDKEEPVTPTSGGGPMSPQDDEAEEESDNELSSGTGDVSKDC |
RABGAP1L Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RABGAP1L |
RABGAP1L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-210 of human RABGAP1L (NP_055672.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China