Antibodies

Jump to Filters
View as table Download
RABGGTB Rabbit Polyclonal Antibody
TA346725

USD 475.00

5 Days

Rabbit Polyclonal Anti-RABGGTB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABGGTB antibody: synthetic peptide directed towards the middle region of human RABGGTB. Synthetic peptide located within the following region: PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
RABGGTB Rabbit Polyclonal Antibody
TA380656

USD 220.00

3 Weeks

RABGGTB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human RABGGTB (NP_004573.2).
Modifications Unmodified