Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN |
Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG |
Rabbit polyclonal anti-RAD21 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD21. |
Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rad21 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Rad21 . |
RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAD21 mouse monoclonal antibody,clone OTI11F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAD21 mouse monoclonal antibody,clone OTI11F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
