Antibodies

View as table Download

Rabbit Polyclonal Anti-RAE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAE1 antibody: synthetic peptide directed towards the C terminal of human RAE1. Synthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE

Rabbit Polyclonal Anti-RAE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAE1 antibody: synthetic peptide directed towards the C terminal of human RAE1. Synthetic peptide located within the following region: SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Rabbit polyclonal antibody to RAE1 (RAE1 RNA export 1 homolog (S. pombe))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 307 and 368 of RAE1 (Uniprot ID#P78406)

Goat Polyclonal Antibody against RAE1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAAEELKPRNKK, from the C Terminus of the protein sequence according to NP_003601.1; NP_001015885.1.

RAE1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAE1

RAE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAE1

RAE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human RAE1 (NP_003601.1).
Modifications Unmodified