Antibodies

Jump to Filters
View as table Download
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA327333

USD 275.00

3 Weeks

Rabbit anti-RAPGEF3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RAPGEF3
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA319816

USD 430.00

5 Days

Rabbit Polyclonal EPAC1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPAC1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EPAC1.
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA340093

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the middle region of human RAPGEF3. Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA340092

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA385131

USD 380.00

4 Weeks

Epac1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Epac1
Epac1 (RAPGEF3) Rabbit Monoclonal Antibody [Clone ID: R05-6B2]
TA385132

USD 380.00

4 Weeks

Epac1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated