Antibodies

Jump to Filters
View as table Download
RD3 Rabbit Polyclonal Antibody
TA333379

USD 375.00

5 Days

Rabbit Polyclonal Anti-RD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RD3 Antibody: synthetic peptide directed towards the N terminal of human RD3. Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV
RD3 Rabbit Polyclonal Antibody
TA380822

USD 220.00

3 Weeks

RD3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human RD3 (NP_898882.1).
Modifications Unmodified