Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RDM1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RDM1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RDM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RDM1 antibody: synthetic peptide directed towards the middle region of human RDM1. Synthetic peptide located within the following region: NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF |
RDM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-284 of human RDM1 (NP_663629.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RDM1