Antibodies

Jump to Filters
View as table Download
RECQL5 Rabbit Polyclonal Antibody
TA341562

USD 375.00

5 Days

Rabbit Polyclonal Anti-RECQL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RECQL5 antibody: synthetic peptide directed towards the middle region of human RECQL5. Synthetic peptide located within the following region: CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
RECQL5 Rabbit Polyclonal Antibody
TA355827

USD 360.00

5 Days

RECQL5 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PP1045