Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-RELM beta Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DSVMDKKIKDVLNS, from the internal region of the protein sequence according to NP_115968.1. |
Rabbit polyclonal anti-RELM-beta antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human RELM-β |
Rabbit Polyclonal Anti-RETNLB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RETNLB antibody: synthetic peptide directed towards the N terminal of human RETNLB. Synthetic peptide located within the following region: CSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVT |
Anti-RETNLB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 24-111 amino acids of human resistin like beta |
RETNLB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1). |
RETNLB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1). |
Active filters
Target Symbol
- RETNLB