Antibodies

View as table Download

Rabbit Polyclonal Anti-RFX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX4 antibody: synthetic peptide directed towards the N terminal of human RFX4. Synthetic peptide located within the following region: STESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATL

Rabbit Polyclonal Anti-RFX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX4 antibody: synthetic peptide directed towards the N terminal of human RFX4. Synthetic peptide located within the following region: QQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVMYSKKGAAWVSETGK

Rabbit Polyclonal Anti-RFX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RFX4 Antibody is: synthetic peptide directed towards the N-terminal region of Human RFX4. Synthetic peptide located within the following region: SETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIM

Rabbit Polyclonal Anti-RFX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RFX4 Antibody: synthetic peptide directed towards the middle region of human RFX4. Synthetic peptide located within the following region: NVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWL

Rabbit Polyclonal Anti-RFX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX4 antibody: synthetic peptide directed towards the N terminal of human RFX4. Synthetic peptide located within the following region: MYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASL