Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal RGS14 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RGS14. |
RGS14 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of Human RGS14. |
Rabbit Polyclonal Anti-Rgs14 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rgs14 antibody is: synthetic peptide directed towards the middle region of Mouse Rgs14. Synthetic peptide located within the following region: LGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGPCGRPLRKSFRREMTG |
RGS14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RGS14 |
RGS14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RGS14 |
RGS14 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RGS14 |
RGS14 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-510 of human RGS14 (NP_006471.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RGS14