Rabbit Polyclonal Anti-Rhox8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Rhox8 antibody: synthetic peptide directed towards the middle region of mouse Rhox8. Synthetic peptide located within the following region: EAAAAAAARDETTAGSSAPVDDRSHDAGASSNGEDRGQGEELIPGGTKGL |
Rabbit Polyclonal Anti-Rhox8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Rhox8 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rhox8. Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE |
Rhox8 Antibody - C-terminal region
| Applications | IHC, IHC-P, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rhox8 |
Germany
Japan
United Kingdom
China