Rabbit Polyclonal Anti-RLN1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RLN1 antibody: synthetic peptide directed towards the middle region of human RLN1. Synthetic peptide located within the following region: EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK |
Relaxin 1 (RLN1) mouse monoclonal antibody, clone 8H11kurd, Purified
| Applications | ELISA, FC |
| Reactivities | Human |
Relaxin 1 (RLN1) mouse monoclonal antibody, clone 8H11kurd, Purified
| Applications | ELISA, FC |
| Reactivities | Human |
Relaxin 1 (RLN1) mouse monoclonal antibody, clone 8H11kurd, Purified
| Applications | ELISA, FC |
| Reactivities | Human |
Rabbit polyclonal anti-Relaxin-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 130 of rat Relaxin-1 |
RLN1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RLN1 |
RLN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RLN1 (NP_008842.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
