Antibodies

Jump to Filters
View as table Download
RNase H1 (RNASEH1) Rabbit Polyclonal Antibody
TA345822

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNASEH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASEH1 antibody: synthetic peptide directed towards the middle region of human RNASEH1. Synthetic peptide located within the following region: EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED