Rabbit polyclonal RNF166 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RNF166 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-97 amino acids from the Central region of human RNF166. |
Rabbit Polyclonal Anti-RNF166 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF166 antibody: synthetic peptide directed towards the middle region of human RNF166. Synthetic peptide located within the following region: RVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQA |
Rnf166 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
RNF166 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RNF166 (NP_849163.1). |
| Modifications | Unmodified |
RNF166 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RNF166 (NP_849163.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China