Rabbit Polyclonal Anti-Rpl32 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rpl32 antibody is: synthetic peptide directed towards the middle region of Rpl32. Synthetic peptide located within the following region: GSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKA |
Rabbit Polyclonal Anti-RPL32 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32. Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG |
RPL32 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RPL32 (NP_000985.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China