Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RPL35 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL35. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Rpl35 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl35 antibody is: synthetic peptide directed towards the middle region of Mouse Rpl35. Synthetic peptide located within the following region: INQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRK |
RPL35 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL35 |
RPL35 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human RPL35 (NP_009140.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RPL35