Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-RPL5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL5. |
Rabbit polyclonal Anti-Rpl5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG |
Rabbit polyclonal Anti-RPL5 Antibody
| Applications | WB |
| Reactivities | Arabidopsis thaliana, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP |
RPL5 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse RPL5 |
Active filters
Target Symbol
- RPL5