Antibodies

View as table Download

Rabbit polyclonal anti-RPLP2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPLP2.

RPLP2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 20~49 amino acids from the N-terminal region of Human RPLP2.

Rabbit Polyclonal Anti-RPLP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPLP2 antibody is: synthetic peptide directed towards the N-terminal region of Human RPLP2. Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN

Rabbit Polyclonal Anti-RPLP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPLP2

RPLP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPLP2