Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RPLP2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPLP2. |
Antibodies
View as table Download
RPLP2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 20~49 amino acids from the N-terminal region of Human RPLP2. |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPLP2 antibody is: synthetic peptide directed towards the N-terminal region of Human RPLP2. Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPLP2 |
RPLP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPLP2 |
Active filters
Target Symbol
- RPLP2