Antibodies

View as table Download

Rabbit Polyclonal Anti-RPS16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL

Rabbit Polyclonal Anti-RPS16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the middle region of human RPS16. Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC

RPS16 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 44-74 amino acids from the Central region of Human RPS16.

RPS16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPS16

RPS16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPS16

RPS16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human RPS16 (NP_001011.1).
Modifications Unmodified