Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RPS21 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Antibodies
View as table Download
Rabbit polyclonal RPS21 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RPS21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 44-71 amino acids from the C-terminal region of human RPS21. |
Rabbit Polyclonal Anti-RPS21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the N terminal of human RPS21. Synthetic peptide located within the following region: MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF |
Rabbit Polyclonal Anti-RPS21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the middle region of human RPS21. Synthetic peptide located within the following region: NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF |
RPS21 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
RPS21 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RPS21. |
Active filters
Target Symbol
- RPS21