Antibodies

Jump to Filters
View as table Download
Viperin (RSAD2) Rabbit Polyclonal Antibody
TA329507

USD 310.00

5 Days

Rabbit Polyclonal anti-RSAD2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the C terminal of human RSAD2. Synthetic peptide located within the following region: YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
Viperin (RSAD2) Rabbit Polyclonal Antibody
TA329506

USD 310.00

5 Days

Rabbit Polyclonal anti-RSAD2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the N terminal of human RSAD2. Synthetic peptide located within the following region: PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
Viperin (RSAD2) Mouse Monoclonal Antibody [Clone ID: OTI4D12]
CF505799

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RSAD2 mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Viperin (RSAD2) Rabbit Polyclonal Antibody
TA381167

USD 220.00

3 Weeks

RSAD2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-361 of human RSAD2 (NP_542388.2).
Modifications Unmodified