Rabbit Polyclonal Anti-RTN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTN1 antibody: synthetic peptide directed towards the N terminal of human RTN1. Synthetic peptide located within the following region: EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR |
Rabbit Polyclonal Anti-RTN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTN1 antibody: synthetic peptide directed towards the middle region of human RTN1. Synthetic peptide located within the following region: MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE |
RTN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RTN1 |
RTN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RTN1 |
RTN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-340 of human RTN1 (NP_066959.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China