Antibodies

View as table Download

Rabbit Polyclonal RTN4RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal RTN4RL2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RTN4RL2.

Rabbit Polyclonal Anti-RTN4RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RTN4RL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL2. Synthetic peptide located within the following region: DYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPH

Recombinant Anti-NgR2 (Clone P14)

Applications ELISA, FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated