Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RUFY1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RUFY1. |
Antibodies
View as table Download
Goat Anti-RUFY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKNEAITSFEGKT, from the internal region of the protein sequence according to NP_079434.3; NP_001035541.1. |
Rabbit Polyclonal Anti-RUFY1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL |
RUFY1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 439-708 of human RUFY1 (NP_079434.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RUFY1