Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal RUNX2 Antibody (S533)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids surrounding S533 of human RUNX2. |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the C terminal of human RUNX2. Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY |
RUNX2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human CBFA1 |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal anti-Runx2 antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Runx2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the N terminal of human RUNX2. Synthetic peptide located within the following region: MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQ |
Carrier-free (BSA/glycerol-free) RUNX2 mouse monoclonal antibody, clone OTI3E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-CBFA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 320-336 amino acids of Human Core-binding factor subunit alpha-1 |
RUNX2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RUNX2 |
RUNX2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 242-521 of human RUNX2 (NP_001019801.3). |
| Modifications | Unmodified |
RUNX2 mouse monoclonal antibody, clone OTI3E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
RUNX2 mouse monoclonal antibody, clone OTI3E12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RUNX2 mouse monoclonal antibody, clone OTI3E12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RUNX2 mouse monoclonal antibody, clone OTI3E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RUNX2