Rabbit Polyclonal Anti-S100A3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-S100A3 antibody: synthetic peptide directed towards the N terminal of human S100A3. Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF |
Rabbit polyclonal anti-S100A3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human S100A3. |
S100A3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A3 (NP_002951.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
