Antibodies

Jump to Filters
View as table Download
NICE2 (S100A7A) Rabbit Polyclonal Antibody
TA337753

USD 375.00

5 Days

Rabbit Polyclonal Anti-S100A7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-S100A7A antibody is: synthetic peptide directed towards the middle region of Human S100A7A. Synthetic peptide located within the following region: CDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPC