Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Rabbit polyclonal Anti-Sphingosine 1-Phosphate Receptor 2
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide ERQVALAKVKLYGSDKSC, corresponding to amino acid residues 129-146 of mouse Sphingosine 1-Phosphate Receptor 2 (S1PR2), (Accession P52592). 2nd intracellular loop. |
Rabbit polyclonal anti-EDG5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EDG5. |
Rabbit Polyclonal Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE |
Rabbit Polyclonal Anti-S1PR2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human S1PR2 |
S1PR2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human S1PR2 |
S1PR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S1PR2 . |
Active filters
Target Symbol
- S1PR2