Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against SAR1B / SARA2
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DHERLLESKEELD, from the internal region of the protein sequence according to NP_001028675.1; NP_057187.1. |
Rabbit Polyclonal Anti-SAR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SAR1B Antibody: synthetic peptide directed towards the middle region of human SAR1B. Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ |
SAR1B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SAR1B |
SAR1B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SAR1B |
Active filters
Target Symbol
- SAR1B