Rabbit Polyclonal Anti-SAV1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Sav1 antibody is: synthetic peptide directed towards the C-terminal region of Sav1. Synthetic peptide located within the following region: PCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARA |
Carrier-free (BSA/glycerol-free) SAV1 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SAV1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SAV1 |
SAV1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SAV1 |
SAV1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SAV1. |
SAV1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human SAV1 (NP_068590.1). |
| Modifications | Unmodified |
SAV1 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SAV1 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SAV1 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SAV1 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
