Antibodies

View as table Download

Rabbit Polyclonal Anti-C6orf64 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C6orf64 antibody: synthetic peptide directed towards the C terminal of human C6orf64. Synthetic peptide located within the following region: MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Carrier-free (BSA/glycerol-free) C6orf64 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

C6orf64 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

C6orf64 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated