Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal LIMPII/SR-B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114] |
Goat Anti-LIMP2 / SCARB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKANIQFGDNGTTIS, from the internal region of the protein sequence according to NP_005497.1. |
SCARB1 / SR-BI (aa238-250) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (NGLSKVDFWHSDQ) |
SCARB1 / SR-BI Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C Terminus (TSAPKGSVLQEAK) |
Rabbit Polyclonal Anti-SCARB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCARB2 antibody is: synthetic peptide directed towards the C-terminal region of Human SCARB2. Synthetic peptide located within the following region: KSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPL |
SCARB2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SCARB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SCARB2 |
SCARB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCARB2 |
SR-B2/LIMPII Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human SR-B2/LIMPII (NP_005497.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SCARB2