Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SCN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED |
Rabbit Polyclonal Anti-SCN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
Rabbit Polyclonal Anti-SCN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH |
Mouse monoclonal Anti-Nav 1.5 Clone 4G8:1G7
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI5E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI4B11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-SCN5A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit |
SCN5A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SCN5A |
SCN5A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of mouse SCN5A |
| Modifications | Unmodified |
SCN5A mouse monoclonal antibody,clone OTI5E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI5E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SCN5A