Antibodies

Jump to Filters
View as table Download
Scn8a Mouse Monoclonal Antibody [Clone ID: S87A-10]
TA309441

USD 410.00

In Stock

Mouse Monoclonal anti-SCN8A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Scn8a Mouse Monoclonal Antibody [Clone ID: K87A/10]
73-026

USD 530.00

3 Weeks

Scn8a mouse monoclonal antibody, clone K87A/10

Applications IF, IHC, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Scn8a Mouse Monoclonal Antibody [Clone ID: K87A/10]
75-026

USD 600.00

3 Weeks

Scn8a mouse monoclonal antibody, clone K87A/10

Applications IF, IHC, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Scn8a Rabbit Polyclonal Antibody
TA329034

USD 585.00

3 Weeks

Rabbit polyclonal Anti-NaV1.6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CIANHTGVDIHCCRNGDFQKNG, corresponding to amino acid residues 1042-1061 of rat Nav1.6.? ? Intracellular loop between domains II and III.
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody
TA338572

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCN8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody
TA355747

USD 360.00

5 Days

SCN8A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human SCN8A