Antibodies

View as table Download

Rabbit Polyclonal Anti-SCNM1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-SCNM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SCNM1. Synthetic peptide located within the following region: EVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSS

SCNM1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SCNM1

SCNM1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SCNM1

SCNM1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SCNM1