Antibodies

View as table Download

Rabbit Polyclonal SCUBE1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SCUBE1 antibody was raised against a 14 amino acid synthetic peptide near the center of human SCUBE1.

Rabbit Polyclonal Anti-SCUBE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCUBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE1. Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Rabbit Polyclonal Anti-Scube1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Scube1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Scube1. Synthetic peptide located within the following region: NCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEVEMKVDEASGTCEA