Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-SDCCAG8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TINDQSQYIHHLEAE, from the internal region of the protein sequence according to NP_006633.1. |
Rabbit Polyclonal Anti-SDCCAG8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDCCAG8 antibody: synthetic peptide directed towards the N terminal of human SDCCAG8. Synthetic peptide located within the following region: HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE |
Rabbit Polyclonal Anti-SDCCAG8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDCCAG8 antibody: synthetic peptide directed towards the middle region of human SDCCAG8. Synthetic peptide located within the following region: IQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKM |
Active filters
Target Symbol
- SDCCAG8