Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 35 of 35 results

(reset)

Selenium Binding Protein 1 (SELENBP1) Rabbit Polyclonal Antibody

TA346582

USD 475.00

5 Days

Rabbit Polyclonal Anti-SELENBP1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SELENBP1 antibody: synthetic peptide directed towards the C terminal of human SELENBP1. Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Selenium Binding Protein 1 (SELENBP1) Rabbit Polyclonal Antibody

TA346581

USD 475.00

5 Days

Rabbit Polyclonal Anti-SELENBP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SELENBP1 antibody: synthetic peptide directed towards the N terminal of human SELENBP1. Synthetic peptide located within the following region: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD

1 / 3

2 / 3

3 / 3

Previous Next

Selenium Binding Protein 1 (SELENBP1) Rabbit Polyclonal Antibody

TA327007

USD 374.00

3 Weeks

Rabbit anti-SELENBP1 Polyclonal Antibody

Applications	ICC/IF, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human SELENBP1

1 / 2

2 / 2

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]

CF504700

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3H1]

CF504701

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF504702

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D2]

CF504738

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3C6]

CF504739

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

CF504740

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SELENBP1 mouse monoclonal antibody,clone OTI2B12

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SELENBP1 Rabbit Polyclonal Antibody

TA365871

USD 380.00

4 Weeks

SELENBP1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human SELENBP1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SELENBP1 Rabbit Polyclonal Antibody

TA370214

USD 380.00

4 Weeks

SELENBP1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human SELENBP1

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]

TA504700

USD 379.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A3]

TA504700AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3A3, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]

TA504700BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3A3, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]

TA504700S

USD 159.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3H1]

TA504701

USD 379.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, Clone Clone Clone Clone, clone OTI3H1 (formerly 3H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H1]

TA504701AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3H1, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]

TA504701BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3H1, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3H1]

TA504701S

USD 159.00

2 Days

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, Clone Clone Clone Clone, clone OTI3H1 (formerly 3H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA504702

USD 379.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, Clone Clone Clone, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

TA504702AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3D4, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

TA504702BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3D4, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA504702S

USD 159.00

2 Days

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, Clone Clone Clone, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D2]

TA504738

USD 379.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D2]

TA504738AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3D2, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D2]

TA504738BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3D2, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3D2]

TA504738S

USD 159.00

2 Days

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3C6]

TA504739

USD 379.00

In Stock

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]

TA504739AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3C6, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]

TA504739BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 3C6, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI3C6]

TA504739S

USD 159.00

2 Days

SELENBP1 (Selenium Binding Protein 1) mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504740

USD 379.00

In Stock

SELENBP1 mouse monoclonal antibody,clone OTI2B12

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B12]

TA504740AM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 2B12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B12]

TA504740BM

USD 420.00

5 Days

SELENBP1 mouse monoclonal antibody,clone 2B12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504740S

USD 159.00

2 Days

SELENBP1 mouse monoclonal antibody,clone OTI2B12

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 35 of 35 results